PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10020000m
Common NameCICLE_v10019956mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 474aa    MW: 52090.8 Da    PI: 5.6363
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10020000mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.6e-34254308155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Ciclev10020000m 254 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 308
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.061251311IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-32252310IPR009057Homeodomain-like
SuperFamilySSF466893.76E-18252308IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-25254308IPR006447Myb domain, plants
PfamPF002494.4E-10256307IPR001005SANT/Myb domain
PfamPF143791.0E-24339384IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MEARPLSIQR SSARQLNNLG VSGPMSSSLP VLPTPLEDTF SKLPNSQQVY MEQELRTRPL  60
APAPHIPANS GVVGHIFSSS SGLSSDLQYS SASPHEKLPR TTSFISQSST PIPQTSHSGL  120
PQSSTSSHYT KESSSSWCPE SLPGYVDFAA NTPVQNSQME GSSCSGAIVS EEFSKRNDWH  180
EWADQLITDD DPLGSSWNEI LADTSMTEME PKVPKTPTSM PAHRTQVHQQ LPASSTEIRT  240
VVTPSASANN APAKPRMRWT PELHEAFVEA VNQLGGSERA TPKGVLKLMK VEGLTIYHVK  300
SHLQKYRTAR YRPDSSEGSS EKRLTPLEEI SSLDLKTGIE ITEALRLQME VQKRLHEQLE  360
IQRNLQLRIE EQGKYLQMMF EKQKSGIDML KGSSSNQENS STSLAKSELE GTQVDHDKKG  420
SDTANANSTN EESSQPKELD GKQKAPETEA PENAELNVSE LSSQPSKRPR TEE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443761.10.0hypothetical protein CICLE_v10019956mg
TrEMBLV4U4A10.0V4U4A1_9R
STRINGPOPTR_0002s25960.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-112phosphate starvation response 1